PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG020390.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 513aa    MW: 56224.7 Da    PI: 4.9025
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG020390.2genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.3e-183784148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +l+d+vk++G g+W+++ ++ g+ R++k+c++rw ++l
      CCG020390.2 37 KGPWTPAEDAILIDYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 84
                     79******************************************9986 PP

2Myb_DNA-binding50.64.6e-1690133146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ +++++++ +G++ W++ a++++ gRt++++k++w++
      CCG020390.2  90 KGAFTPEEENRIIELHATMGNK-WARMAAELP-GRTDNEIKNYWNT 133
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.5573284IPR017930Myb domain
SuperFamilySSF466892.58E-3034131IPR009057Homeodomain-like
SMARTSM007173.8E-163686IPR001005SANT/Myb domain
PfamPF002493.1E-163784IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-253891IPR009057Homeodomain-like
CDDcd001679.92E-133984No hitNo description
PROSITE profilePS5129425.25685139IPR017930Myb domain
SMARTSM007176.6E-1689137IPR001005SANT/Myb domain
PfamPF002494.3E-1590133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2592137IPR009057Homeodomain-like
CDDcd001671.85E-1192133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MMNGSKDSKR SKDCRDSPAA DEANGGEMMG GMIPLKKGPW TPAEDAILID YVKKHGEGNW  60
NAVQKHSGLF RCGKSCRLRW ANHLRPDLKK GAFTPEEENR IIELHATMGN KWARMAAELP  120
GRTDNEIKNY WNTRIKRLQR TGLPIYPPDV CLQLFKTIQD GQNMGTSQTG DTYDPDLMQT  180
DHFKIPEVEF KNLELSRDVL SYSSGLFDTS SSSMLKQGVG SSYGNAVVFP TIHPAKRLRE  240
SQTIFTGLDG CVGRGMPMFD QLTDYPCGKI IEHSGLSPPY DPDLSTYDQP PWDVFPGSHA  300
ILNDNTSSSN GPICGAMKLE LPSLQYSESQ QDSWGTPTSP LPSLESVDTL IQSPPTKEMR  360
SDGQSPRSSG LLEAVLYESR TLKNSKKCSG HPTSDVSVAF GGVNVSPLNT SATEWEVYAD  420
LNSPSGYSAS SLFSECTPVS GSSPDGRAYN AEPEPVDQDL IPYVEARKAS DQTDCNRPDV  480
LLGSAWFAPS NNCHKDQFFQ TDDVVAVLGG DQP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-32311371106B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011003856.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLB9HPW80.0B9HPW8_POPTR; Uncharacterized protein
STRINGPOPTR_0009s02380.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.34e-93myb domain protein 33